Bacterial taxon 216597
Protein WP_000132169.1
flagellar basal body-associated protein FliL
Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
Gene fliL, UniProt A0A0H3NE42
>WP_000132169.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|flagellar basal body-associated protein FliL
MTDSAINKKSKRSIWIPLLVLITLAACATAGYSYWRMQQQPTTNAKAEPAPPPAPVFFALDTFTVNLGDADRVLYIGVTLRLKDEATRARLNEYLPEVRSRLLLLFSRQNAAELSTEAGKQKLIAAIKETLAAPLVAGQPKQVVTDVLYTAFILR
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 4 h | ●●●●● -4.71 | -4.71042958780928 | 0.0023 | 26789254 | Bacterial control measured at 37ºC |
Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 24 h | ●●●●○ -3.69 | -3.69318504144707 | 0.00037 | 26789254 | Bacterial control measured at 37ºC |
Retrieved 2 of 1 entries in 101.2 ms
(Link to these results)