Bacterial taxon 216597
Protein WP_001597849.1
hypothetical protein
Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
Gene n/a, UniProt A0A0H3NBI2
>WP_001597849.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|hypothetical protein
MAMTSRPNYLGSRGILCVCTTAVNRNFSALSPTIDVFLTNCLPDYIVVLSLAKQCYLVMEGDNNCTTDYQMTFLVR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 4 h | ●●●●● 5.02 | 5.0174755495391 | 9.4e-6 | 26789254 | Bacterial control measured at 37ºC |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 24 h | ●●●●○ 3.27 | 3.2673282421638 | 0.0083 | 26789254 | Bacterial control measured at 37ºC |
Retrieved 2 of 1 entries in 18.2 ms
(Link to these results)