Bacterial taxon 216597
Protein WP_000803229.1
hypothetical protein
Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
Gene n/a, UniProt A0A0H3NMH1
>WP_000803229.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|hypothetical protein
MKPLIFTLSLLALTGCTITRQAQVSEASPISGIVRLTYNQPLFFTSRTDDYVSHGTATRECQQMGYADAVSFGQPVGTCSIYAGSLCLNTRFTLSWQCRGVAVPQIMPLYY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 4 h | ●●●●● -5.94 | -5.93538758353085 | 0.00022 | 26789254 | Bacterial control measured at 37ºC |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 24 h | ●●●●○ -3.57 | -3.56677210575979 | 5.1e-5 | 26789254 | Bacterial control measured at 37ºC |
Retrieved 2 of 1 entries in 83.3 ms
(Link to these results)