Bacterial taxon 216597
Protein WP_010989049.1
PagK-like protein
Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
Gene n/a, UniProt A0A0H3NG61
>WP_010989049.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|PagK-like protein
MPKFNRQRIIKHVKSVFLAMILILPSSLYSALTIAADSQDHKKEETIKPMPQKWCNLWPAGIPFPEDWFKMCRGY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 4 h | ●●●●● 7.67 | 7.67191175197615 | 3.3e-7 | 26789254 | Bacterial control measured at 37ºC |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 24 h | ●●●●● 5.36 | 5.35928499384692 | 0.00096 | 26789254 | Bacterial control measured at 37ºC |
Retrieved 2 of 1 entries in 87.6 ms
(Link to these results)