Host taxon 9606
Protein NP_002695.1
platelet basic protein preproprotein
Homo sapiens
Gene PPBP, UniProt P02775
>NP_002695.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|platelet basic protein preproprotein
MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | infected host | Monocytic infected cells | 24 h | ●●●○○ 2.88 | 2.87582851231758 | 9.9e-5 | 32071273 | |
Retrieved 1 of 1 entries in 49.2 ms
(Link to these results)