Host taxon 9606
Protein NP_001180303.1
resistin precursor
Homo sapiens
Gene RETN, UniProt Q9HD89
>NP_001180303.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|resistin precursor
MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | infected host | Monocytic infected cells | 24 h | ●●●●● 7.26 | 7.26063780801166 | 9.9e-6 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)