Host taxon 9606
Protein NP_005606.1
ribonuclease K6 precursor
Homo sapiens
Gene RNASE6, UniProt Q93091
>NP_005606.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|ribonuclease K6 precursor
MVLCFPLLLLLLVLWGPVCPLHAWPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | infected host | Monocytic infected cells | 24 h | ●●●●○ -3.43 | -3.43135675978528 | 2.1e-6 | 32071273 | |
Retrieved 1 of 2 entries in 49.5 ms
(Link to these results)