Bacterial taxon 216597
Protein WP_001574409.1
SctI family type III secretion system inner rod subunit SsaI
Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
Gene ssaI, UniProt A0A0H3NB02
>WP_001574409.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|SctI family type III secretion system inner rod subunit SsaI
MSVVPVSTQSYVKSSAEPSQEQINFFEQLLKDEASTSNASALLPQVMLTRQMDYMQLTVGVDYLARISGAASQALNKLDNMA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 24 h | ●●●●● 5.62 | 5.618529872708 | 0.00014 | 26789254 | Bacterial control measured at 37ºC |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 4 h | ●●●●● 5.61 | 5.6072658728861 | 0.00023 | 26789254 | Bacterial control measured at 37ºC |
Retrieved 2 of 1 entries in 0.7 ms
(Link to these results)