Bacterial taxon 216597
Protein WP_000350226.1
type III secretion system needle filament protein SsaG
Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
Gene ssaG, UniProt A0A0H3NKW1
>WP_000350226.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|type III secretion system needle filament protein SsaG
MDIAQLVDMLSHMAHQAGQAINDKMNGNDLLNPESMIKAQFALQQYSTFINYESSLIKMIKDMLSGIIAKI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 4 h | ●●●●● 7.15 | 7.14521715998846 | 6.9e-6 | 26789254 | Bacterial control measured at 37ºC |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 24 h | ●●●●● 6.52 | 6.52313878142759 | 4.2e-5 | 26789254 | Bacterial control measured at 37ºC |
Retrieved 2 of 1 entries in 39.5 ms
(Link to these results)