Bacterial taxon 216597
Protein WP_001535993.1
virulence protein PagD
Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
Gene pagD, UniProt A0A0H3NAS4
>WP_001535993.1|Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344|virulence protein PagD
MKHHAFMLWSLLIFSFHVLASSGHCSGLQQASWDIFIYDFGSKTPQPPTNTDKKQARQISSPSCPTTKPMMSAPVNDARKGNTFSRT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 4 h | ●●●●● 5.88 | 5.87689467178806 | 0.002 | 26789254 | Bacterial control measured at 37ºC |
| Human (Homo sapiens) | 9606 | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 | 216597 | pathogen | Hela-S3 cells | 24 h | ●●●●● 4.06 | 4.05535947981959 | 0.049 | 26789254 | Bacterial control measured at 37ºC |
Retrieved 2 of 1 entries in 1.3 ms
(Link to these results)