Bacterial taxon 373153
Protein WP_000167624.1
ACP S-malonyltransferase
Streptococcus pneumoniae D39
Gene fabD, UniProt A0A0H2ZQZ1
>WP_000167624.1|Streptococcus pneumoniae D39|ACP S-malonyltransferase
MTKTAFLFAGQGAQYLGMGRDFYDQYPIVKETIDRASQVLGYDLRYLIDTEEDKLNQTRYTQPAILATSVAIYRLLQEKGYQPDMVAGLSLGEYSALVASGALDFEDAVALVAKRGAYMEEAAPADSGKMVAVLNTPVEVIEEACQKASELGVVTPANYNTPAQIVIAGEVVAVDRAVELLQEAGAKRLIPLKVSGPFHTSLLEPASQKLAETLAQVSFSDFTCPLVGNTEAAVMQKEDIAQLLTRQVKEPVRFYESIGVMQEAGISNFIEIGPGKVLSGFVKKIDQTAHLAHVEDQASLVALLEK
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●○ -3.3 | -3.29693452035055 | 1.1e-45 | 27678244 | |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ -2.98 | -2.97800109412384 | 1.8e-37 | 27678244 | |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.51 | -2.51005155025237 | 4.2e-27 | 27678244 | |
Retrieved 3 of 1 entries in 3.5 ms
(Link to these results)