Bacterial taxon 373153
Protein WP_001809467.1
AraC family transcriptional regulator
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZMR6
>WP_001809467.1|Streptococcus pneumoniae D39|AraC family transcriptional regulator
MTLNEYILQYRLKQAIDKMAESPNSPLSAISDQVGFSDYKYFAKVFKKYLHISPKKLKSLGRIVK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●●○ 3.57 | 3.57295987716494 | 1.7e-56 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.72 | 2.71947208797962 | 1.6e-32 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.7 | 2.69564563829044 | 1.5e-31 | 27678244 | |
Retrieved 3 of 1 entries in 25.9 ms
(Link to these results)