Bacterial taxon 373153
Protein WP_000148137.1
biofilm-regulating peptide BriC
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNA9
>WP_000148137.1|Streptococcus pneumoniae D39|biofilm-regulating peptide BriC
MTGTETFTVISTEDLEQTSGGLAVWEDGYSRWLYYREFAPYMRQGALNSYIDAWKYGFRTG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●●○ -3.48 | -3.47846607266604 | 7.6e-13 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.58 | 2.57986505305557 | 1.0e-7 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.77 | -1.77109433460725 | 0.00034 | 27678244 | |
Retrieved 3 of 1 entries in 2.4 ms
(Link to these results)