Bacterial taxon 373153
Protein WP_000917304.1
co-chaperone GroES
Streptococcus pneumoniae D39
Gene groS, UniProt Q04IQ2
>WP_000917304.1|Streptococcus pneumoniae D39|co-chaperone GroES
MLKPLGDRVLLKIEEKEQTVGGFVLAGSAQEKTKTAQVVATGQGVRTLNGDLVAPSVKTGDRVLVEAHAGLDVKDGDEKYIIVGEANILAIIEE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●○ 3.66 | 3.6576975831373 | 3.1e-41 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.21 | 2.21498211477769 | 7.5e-16 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.65 | 1.65144427866529 | 2.0e-9 | 27678244 | |
Retrieved 3 of 1 entries in 95 ms
(Link to these results)