Bacterial taxon 373153
Protein WP_000821284.1
CPBP family intramembrane metalloprotease
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZMG5
>WP_000821284.1|Streptococcus pneumoniae D39|CPBP family intramembrane metalloprotease
MKRIIPVYIFQQVNVLLVSLYLLKFLCIGELTILQILYGSSLISFLWMYGQRKQAHKVNMKSRMKWLGVEFVSLLIISLCFSLIHAQGSTNQANLIGLQHQIPWFSFLLFLINASMVEEFLYREILCNLVRKLDIRVALTSVLFALAHHTGTILAWCLYVSLGMFLGMVRYKSDLWGSMGLHLVWNLLVYSLLLF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●● -4.08 | -4.07795865334016 | 1.9e-19 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●●○ -3.9 | -3.90094142615437 | 1.3e-20 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●●○ -3.64 | -3.64251832376763 | 6.5e-20 | 27678244 | |
Retrieved 3 of 1 entries in 137.2 ms
(Link to these results)