Bacterial taxon 373153
Protein WP_001054489.1
dihydroorotate dehydrogenase electron transfer subunit
Streptococcus pneumoniae D39
Gene pyrK, UniProt A0A0H2ZMC4
>WP_001054489.1|Streptococcus pneumoniae D39|dihydroorotate dehydrogenase electron transfer subunit
MNLTCKKRLGVIRLETMKVVAQEEIAPAIFELVLEGEMVEAMRAGQFLHLRVPDDAHLLRRPISISSIDKANKQCHLIYRIEGAGTAIFSTLSQGDTLDVMGPQGNGFDLSDLDEQNQVLLVGGGIGVPPLLEVAKELHERGVKVVTVLGFANKDAVILKTELAQYGQVFVTTDDGSYGIKGNVSVVINDLDSQFDAVYSCGAPGMMKYINQTFDDHPRAYLSLESRMACGMGACYACVLKVPESETVSQRVCEDGPVFRTGTVVL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●●● 4.4 | 4.40376870677654 | 1.6e-113 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●● 4.22 | 4.21568896629868 | 4.4e-104 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●●○ 3.16 | 3.16325562097667 | 6.3e-59 | 27678244 | |
Retrieved 3 of 1 entries in 27.8 ms
(Link to these results)