Bacterial taxon 373153
Protein WP_001033170.1
flavodoxin family protein
Streptococcus pneumoniae D39
Gene wrbA, UniProt A0A0H2ZPP3
>WP_001033170.1|Streptococcus pneumoniae D39|flavodoxin family protein
MNKIFIYAGVRNHNSKTLEYTKRLSSIISSRNNVDISFRTPFNSELEISNSDSEELFKKGIDRQSNADDGGVIKKELLESDIIIISSPVYLQNVSVDTKNFIERIGGWSHLFRLAGKFVVTLDVAESNGSDNVSEYLRDIFSYMGGQILHQVSITNSLKDIAEAQLMEATYKIEDVLEGKIKYKTTDYQERAYQTLKLILENYDSEHFEKMYWEKKRLFEANSLEEWYYVENIK
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●○ 3.56 | 3.55818100198733 | 1.1e-73 | 27678244 | |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●●○ 3.22 | 3.2154096294827 | 2.1e-60 | 27678244 | |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.6 | 2.59657503827261 | 6.2e-40 | 27678244 | |
Retrieved 3 of 1 entries in 12.5 ms
(Link to these results)