Bacterial taxon 373153
Protein WP_000743331.1
gamma-glutamyl-gamma-aminobutyrate hydrolase family protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZRF7
>WP_000743331.1|Streptococcus pneumoniae D39|gamma-glutamyl-gamma-aminobutyrate hydrolase family protein
MKKPVIGITGNEKTHPDDDIMMSYAAKGFVEGVKDAGGIPIILPIGDQEMACHYISLIDKLILTGGQNVDPKFYGEPKTIDSDDYHLQRDIFELALIKEAIKQKKPIFSVCRGTQLFNVAMGGTLYQDIEDHWQDSSVEYTTQRLVTETDTVLQEIYGEISHINSFHHQSIKDLAPNLKVVAHDPKDGIIEAVMSTDDVAFLGVQWHPELLFENRPKDKKLFDYVVNEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●○ 3.47 | 3.47218135717121 | 3.9e-181 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.82 | 0.819318647616778 | 3.9e-11 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.8 | 0.802222014278197 | 7.8e-11 | 27678244 | |
Retrieved 3 of 1 entries in 53.3 ms
(Link to these results)