Bacterial taxon 373153
Protein WP_000203066.1
glutathione peroxidase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZQC6
>WP_000203066.1|Streptococcus pneumoniae D39|glutathione peroxidase
MTSLYDFSVLNQNNQATPLDSYRGKVLLIVNTATGCGLTPQYQGLQELYERYQDQGFEILDFPCNQFMGQAPGSAEEINTFCSLHFQTTFPRFAKIKVNGKEADPLYVWLKDHKSGPLGKRIEWNFAKFLIGRDGQVFERFSSKTDPKQIEEAIQTLL
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.87 | 2.87156495188324 | 7.4e-93 | 27678244 | |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.76 | 2.76040804070254 | 3.2e-86 | 27678244 | |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.71 | 2.71330448450131 | 7.8e-84 | 27678244 | |
Retrieved 3 of 1 entries in 71.1 ms
(Link to these results)