Bacterial taxon 373153
Protein WP_000119153.1
GntR family transcriptional regulator
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZQS8
>WP_000119153.1|Streptococcus pneumoniae D39|GntR family transcriptional regulator
MSWTFDNKKPIYLQIMEKIKLQIVSHTLEPNQQLPTVRELASEAGVNPNTIQRALSDLEREGFVYSKRTTGRFVTKDKELIAQSRKQLSEEELEHFVSSMTHFGYEKEELPGVVSDYIKGV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●●○ -3.56 | -3.55982908205867 | 5.5e-84 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●●○ -3.53 | -3.52840682092554 | 4.9e-82 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ -2.13 | -2.12572049795581 | 8.3e-31 | 27678244 | |
Retrieved 3 of 1 entries in 27.2 ms
(Link to these results)