Bacterial taxon 373153
Protein WP_001856111.1
hypothetical protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZMC8
>WP_001856111.1|Streptococcus pneumoniae D39|hypothetical protein
MQILCYFTITVVAKPNNSGEVHLDVSIEDNQGGSGHNFSSVSSSSQTAKYEETGYNNNSSLYITIDKTSDATALLKLKLNNVDNQPATEVPSSGITVKLNAKDNAGNWTSASNKKEVTVKIVSAKPTYPDKILVKNPDNIKDTEKMPLLKN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●●○ -3.57 | -3.56624541685173 | 1.4e-54 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ -2.81 | -2.81321976447171 | 7.2e-34 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ -2.38 | -2.38475792325694 | 9.6e-26 | 27678244 | |
Retrieved 3 of 1 entries in 30.8 ms
(Link to these results)