Bacterial taxon 373153
Protein WP_000808913.1
hypothetical protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZQW3
>WP_000808913.1|Streptococcus pneumoniae D39|hypothetical protein
MKQFVQFYKKDFLAVLVYFILLLSCVLSSTVYLLRCRQYSIHPNVLEWILVLLQDMTTGVYCFPFTYILFFFYLMNNYFNRLECRIRLKSIKHFTSFSFKLAALSTGIWTATLFLLIFLIAFSNGFSFSLEIKEVDFLREFYGISIANNASFFIGFFFSYIAYYFFLSLLTISSFSWFKKSNMSLVFLFTFLFVESLFWIYQLDNGIIGLLPIFQYMVNSNPYALIYWLTLLSIIIPLTVFSVHRNWRRV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.8 | 2.80440000927512 | 1.3e-15 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.63 | 1.63235223194424 | 4.6e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.48 | 1.48333715842362 | 3.5e-5 | 27678244 | |
Retrieved 3 of 1 entries in 48.4 ms
(Link to these results)