Bacterial taxon 373153
Protein WP_000566531.1
hypothetical protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZQF6
>WP_000566531.1|Streptococcus pneumoniae D39|hypothetical protein
MIDLYLSKNRQRNQLLLDFFQNYGIEVSCHSVSEMTKDKLIEMMSYSSDCFEFLSPNLLRFKNRDNLRLTDFVEIILKNPELTIRLPLAVSNKRVYPSLNLEEARALLPRDTKQLIYMAQTHYLSN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●●● -4.44 | -4.43957357389816 | 1.5e-27 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●●○ -3.87 | -3.87380924236146 | 6.6e-28 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●○ -3.5 | -3.49840007331782 | 1.1e-19 | 27678244 | |
Retrieved 3 of 1 entries in 112.6 ms
(Link to these results)