Bacterial taxon 373153
Protein WP_000820180.1
hypothetical protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZP90
>WP_000820180.1|Streptococcus pneumoniae D39|hypothetical protein
MKRGIIYFFIGLSLLVWLVEMFTDWFDQALLRQFICGALGFGFMIFVVFPMGMEWLKGESHDCG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●●○ -3.35 | -3.35158317576864 | 2.6e-57 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●●○ -3.28 | -3.28351843245082 | 4.5e-53 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●○ -3.11 | -3.10829113203982 | 1.7e-45 | 27678244 | |
Retrieved 3 of 1 entries in 22.7 ms
(Link to these results)