Bacterial taxon 373153
Protein WP_000400702.1
hypothetical protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPA1
>WP_000400702.1|Streptococcus pneumoniae D39|hypothetical protein
MEHLVVLSFIFSKFLECGILRKRLNSDKNWRNSTKKLEKNEGKRYDRKEEILEEEHVTY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●○ 3.77 | 3.76816569125774 | 1.4e-29 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●●○ 3.66 | 3.65526166752257 | 6.5e-28 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●●○ 3.05 | 3.04985951624559 | 6.7e-20 | 27678244 | |
Retrieved 3 of 1 entries in 2.8 ms
(Link to these results)