Bacterial taxon 373153
Protein WP_000046028.1
nucleotide exchange factor GrpE
Streptococcus pneumoniae D39
Gene grpE, UniProt Q04LY1
>WP_000046028.1|Streptococcus pneumoniae D39|nucleotide exchange factor GrpE
MAQDIKNEEVEEVQEEEVVETAEETTPEKSELDLANERADEFENKYLRAHAEMQNIQRRANEERQNLQRYRSQDLAKAILPSLDNLERALAVEGLTDDVKKGLAMVQESLIHALKEEGIEEIAADGEFDHNYHMAIQTLPGDDEHPVDTIAQVFQKGYKLHDRILRPAMVVVYN
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●● 4.58 | 4.58100511472043 | 3.6e-29 | 27678244 | |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●●● 4.09 | 4.09432654045855 | 1.7e-23 | 27678244 | |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.53 | 2.52841506607569 | 8.7e-10 | 27678244 | |
Retrieved 3 of 1 entries in 54.3 ms
(Link to these results)