Bacterial taxon 373153
Protein WP_001206713.1
orotidine-5'-phosphate decarboxylase
Streptococcus pneumoniae D39
Gene pyrF, UniProt Q04LJ3
>WP_001206713.1|Streptococcus pneumoniae D39|orotidine-5'-phosphate decarboxylase
MREHRPIIALDFPSFEAVKEFLALFPAEESLYLKVGMELYYAAGPEIVSYLKGLGHSVFLDLKLHDIPNTVKSAMKILSQLGVDMTNVHAAGGVEMMKAAREGLGSQAKLIAVTQLTSTSEAQMQEFQNIQTSLQESVIHYAKKTAEAGLDGVVCSAQEVQVIKQATNPDFICLTPGIRPAGVAVGDQKRVMTPADAYQIGSDYIVVGRPITQAEEPVAAYHAIKDEWTQDWN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●●● 5.18 | 5.17723636879215 | 9.6e-206 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●● 4.52 | 4.52192277303575 | 3.4e-157 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●●○ 3.7 | 3.6994410647401 | 2.6e-105 | 27678244 | |
Retrieved 3 of 1 entries in 1.1 ms
(Link to these results)