Bacterial taxon 373153
Protein WP_000412220.1
peptide deformylase
Streptococcus pneumoniae D39
Gene def-2, UniProt A0A0H2ZM43
>WP_000412220.1|Streptococcus pneumoniae D39|peptide deformylase
MEKKIVKDILFLSQVSQPASQEDLYLARDLQDTLLANRDTCVGLAANMIGVQKRVIIFNLGLVPVVMFNPVLLSFEGSYEAEEGCLSLVGVRSTKRYETIRLAYRDSKWQEQTITLTGFPAQICQHELDHLEGRII
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●○ 3.21 | 3.20578618717112 | 3.4e-118 | 27678244 | |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.4 | 2.3951639365817 | 1.3e-66 | 27678244 | |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.17 | 2.16833279490175 | 2.0e-54 | 27678244 | |
Retrieved 3 of 1 entries in 101.3 ms
(Link to these results)