Bacterial taxon 373153
Protein WP_000945327.1
phosphate uptake regulator PhoU
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNJ7
>WP_000945327.1|Streptococcus pneumoniae D39|phosphate uptake regulator PhoU
MLRLYLENEIIELSNNLETIWVSVLDKYEKLFEYLSNEERIELIKEDLIINESVLNVDKKGYELICLQHPVSYDLRRIISVIKISTDIERIGDRIVEILKNLQIIQNNEILKKIISEIKILHEVIGLHMNRAISCYREEQSGCLDMVVIQKQNEIEELSTNIEKKIMNYIFEDDGNVSEVIGALDIIHHLDKIAHTTQSIYKWIMYRKYGNIN
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●●○ 3.25 | 3.25056062990994 | 1.1e-44 | 27678244 | |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.18 | 2.18113264542928 | 2.0e-20 | 27678244 | |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.1 | 2.09757975352478 | 8.4e-19 | 27678244 | |
Retrieved 3 of 1 entries in 13 ms
(Link to these results)