Bacterial taxon 373153
Protein WP_000822790.1
replication initiator protein A
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZN06
>WP_000822790.1|Streptococcus pneumoniae D39|replication initiator protein A
MKRITANQYQTSERYYKLPKLLFESERYKNMKLEVKVVYSVLKDRLELSLSKGWIDEDGAIYLIYSNSNLMALLGCSKSKLLSM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●●● -4.33 | -4.33336405013432 | 1.1e-18 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●○ -3.74 | -3.74090242163992 | 2.9e-13 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ -3 | -2.99739409087233 | 1.4e-10 | 27678244 | |
Retrieved 3 of 1 entries in 14.2 ms
(Link to these results)