Bacterial taxon 373153
Protein WP_000599104.1
ribosome-associated translation inhibitor RaiA
Streptococcus pneumoniae D39
Gene yfiA, UniProt A0A0H2ZQJ5
>WP_000599104.1|Streptococcus pneumoniae D39|ribosome-associated translation inhibitor RaiA
MIKYSIRGENLEVTEAIRDYVVSKLEKIEKYFQPEQELDARINLKVYREKTAKVEVTIPLGSITLRAEDVSQDMYGSIDLVTDKIERQIRKNKTKIERKNKNKVATGQLFTDALVEDSNIVQSKVVRSKQIDLKPMDLEEAILQMDLLGHDFFIYVDVEDQTTNVIYRREDGEIGLLEVKES
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●●○ 3.75 | 3.75204585654022 | 1.8e-133 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.78 | 2.78179767977771 | 9.1e-74 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.04 | 2.04182048633816 | 3.3e-40 | 27678244 | |
Retrieved 3 of 1 entries in 42.4 ms
(Link to these results)