Bacterial taxon 373153
Protein WP_000424429.1
SPH_0218 family bacteriocin-like peptide
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPG0
>WP_000424429.1|Streptococcus pneumoniae D39|SPH_0218 family bacteriocin-like peptide
MELVLPNNYVVIDEEEMMYLDGGAIYIPRWAITGAITGAAYAALAAAGGGGLQLVLASYGLRSALVAGIVKGLGVLGIHIGNAFANTVIRSIASAGIGAGADWIFTNIIDGWDGRRDNQLRIG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●●○ 3.41 | 3.41354832611217 | 2.8e-125 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●○ 3.23 | 3.23157030866938 | 3.8e-112 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.98 | 2.97519591716377 | 3.8e-95 | 27678244 | |
Retrieved 3 of 1 entries in 20.4 ms
(Link to these results)