Host taxon 9606
Protein NP_064515.2
transcriptional and immune response regulator
Homo sapiens
Gene TCIM, UniProt Q9NR00
>NP_064515.2|Streptococcus pneumoniae D39|transcriptional and immune response regulator
MKAKRSHQAVIMSTSLRVSPSIHGYHFDTASRKKAVGNIFENTDQESLERLFRNSGDKKAEERAKIIFAIDQDVEEKTRALMALKKRTKDKLFQFLKLRKYSIKVH
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 30 min | ●●●●○ -3.58 | -3.58368707353387 | 2.1e-23 | 27678244 | |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ -2.08 | -2.07934073892132 | 9.8e-10 | 27678244 | |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.59 | -1.58964259711736 | 2.4e-5 | 27678244 | |
Retrieved 3 of 1 entries in 22.2 ms
(Link to these results)