Bacterial taxon 373153
Protein WP_000181087.1
two-peptide bacteriocin subunit PneA1
Streptococcus pneumoniae D39
Gene slgA1, UniProt A0A0H2ZP00
>WP_000181087.1|Streptococcus pneumoniae D39|two-peptide bacteriocin subunit PneA1
MTNFNSNEKFCGKSLKSLSADEMSLIYGASDGAEPRWTPTPIILKSAAASSKVCISAAVSGIGGLVSYNNDCLG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●○ 3.98 | 3.9803342262503 | 1.0e-51 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●●○ 3.43 | 3.43088729938462 | 1.2e-38 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●●○ 3.04 | 3.03587945360008 | 1.1e-30 | 27678244 | |
Retrieved 3 of 1 entries in 25.8 ms
(Link to these results)