Bacterial taxon 373153
Protein WP_000786759.1
two-peptide bacteriocin subunit PneA2
Streptococcus pneumoniae D39
Gene slgA2, UniProt A0A0H2ZM88
>WP_000786759.1|Streptococcus pneumoniae D39|two-peptide bacteriocin subunit PneA2
MKNDFVIGKSLKELSLEEMQLVYGGTDGADPRSTIICSATLSFIASYLGSAQTRCGKDNKKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●○ 3.97 | 3.973042409143 | 4.1e-73 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●●○ 3.51 | 3.50854475833385 | 3.6e-57 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.99 | 2.99374148584058 | 3.9e-42 | 27678244 | |
Retrieved 3 of 1 entries in 54.4 ms
(Link to these results)