Bacterial taxon 373153
Protein WP_000220694.1
VOC family protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZQ49
>WP_000220694.1|Streptococcus pneumoniae D39|VOC family protein
MTYEYKSHIYLAETALNVKDLASQTAFYQQVIGLEILSQTETESILGLGGKVLVQLIQAQESGEVREHYGLYHLAILLPTRKALADVLKHLTDLQIPLVGGADHGYSEAIYLEDLEGNGIELYRDKPVSTWDIREDGRIIGVTEALAAQDIYELGERVEPFILAEGTRMGHIHLSVKDSRKSSQFYQKVLGLEDKFSVPSASWIAAGDYHHHLAVNEWRGKGLASRKQGLPGLAYYVIEVAHKKELLTIAQRAQEVDAPIKWMTSSKLEITDSDGIVTRIRLAR
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●●○ 3.16 | 3.15857857497783 | 2.6e-64 | 27678244 | |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.16 | 2.16169550337403 | 1.1e-29 | 27678244 | |
Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.83 | 1.83410728089762 | 7.4e-21 | 27678244 | |
Retrieved 3 of 1 entries in 24.8 ms
(Link to these results)