Bacterial taxon 1314
Protein WP_002991299.1
cold-shock protein
Streptococcus pyogenes
Gene n/a, UniProt A0A4U7IYV6
>WP_002991299.1|Streptococcus pyogenes|cold-shock protein
MAQGTVKWFNAEKGFGFISTENGQDVFAHFSAIQTNGFKTLEEGQKVAFDVEEGQRGPQAVNITKLA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●●●● 6.44 | 6.44002178815979 | 6.2e-51 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)