Bacterial taxon 1314
Protein WP_010922432.1
hypothetical protein
Streptococcus pyogenes
Gene n/a, UniProt A0A4U7HR33
>WP_010922432.1|Streptococcus pyogenes|hypothetical protein
MDADLAQMDVLGLYYDDNHLSLVNTVKAYLKEFGIGESQIAFSYKDLNSGRTAAMNDHQPMIAGSTYKLPLNMLVVDKANYP
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●●○○ 2.9 | 2.89553296835576 | 6.1e-6 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 10.1 ms
(Link to these results)