Bacterial taxon 1314
Protein WP_002982442.1
hypothetical protein
Streptococcus pyogenes
Gene n/a, UniProt A0A4U9C0G5
>WP_002982442.1|Streptococcus pyogenes|hypothetical protein
MKFKKVLVIPALALAATCFLTACGTKKDSKKEEVKEIKMSDIKDDAVSKKTKVVDGEEVTEYTTKDGNVIQIPAGNEEGMESKDAGGSGAPAKN
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●●●○ 3.97 | 3.97173685737919 | 2.9e-31 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 35.2 ms
(Link to these results)