Bacterial taxon 1314
Protein WP_002992105.1
PTS lactose/cellobiose transporter subunit IIA
Streptococcus pyogenes
Gene lacF_1, UniProt A0A4U7GAY6
>WP_002992105.1|Streptococcus pyogenes|PTS lactose/cellobiose transporter subunit IIA
MQVIVPDQIIMGLILNAGDAKQHIYQALKCAKEDDYATSEKEMALADDALLEAHNLQTQFLAQEASGNKSEITALFVHSQDHLMTTITEINLIKEIIDLRKELATK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●●○○ 2.99 | 2.9897997757661 | 0.00047 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)