Bacterial taxon 1314
Protein WP_002992103.1
PTS sugar transporter subunit IIB
Streptococcus pyogenes
Gene licB_1, UniProt A0A4U9C0G1
>WP_002992103.1|Streptococcus pyogenes|PTS sugar transporter subunit IIB
MIKIGLFCAAGFSTGMLVNNMKVAAEKKGIDCQIEAYAQGKLADYAPLLDVALLGPQVAYTLDKSEAICKDNDIPIAVIPMADYGMLDGNKVLDLALSLVKE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●●●○ 3.47 | 3.46578738729904 | 0.0011 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 32.8 ms
(Link to these results)