Bacterial taxon 1314
Protein WP_002991237.1
response regulator transcription factor
Streptococcus pyogenes
Gene irr, UniProt A0A4U7HES6
>WP_002991237.1|Streptococcus pyogenes|response regulator transcription factor
MFKILVVEDDDTISQVICEFLKANNYDPDCVFDGQAALDKWQTTSYDLIILDIMLPSLSGLEVLKTIRKTSDVPIIMLTALDDEYTQLVSFNHLISDYVTKPFSPLILIKRIENVLRVSTPDEKRQIGDLLVDETEHSVYWQGTLVKLTKKEYDIIDYLAKRHQKIVTRDQLMDDIWGYSELDTRVLDNHIKNLRKKMTGIPLKTITGMGYLLGERE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●●●○ 3.08 | 3.07758261881929 | 5.5e-17 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 25.5 ms
(Link to these results)