Bacterial taxon 1314
Protein WP_002993568.1
streptopain
Streptococcus pyogenes
Gene speB_2, UniProt A0A4U9HZM7
>WP_002993568.1|Streptococcus pyogenes|streptopain
MEMHFVRTEPEARRIAETFCAENTQTKTPMRVQQLSYPSDTDHSGGELYIYALSPAGFIIVSGDTRAHTILGYSFDNNLDLNHDNVRSMIEAYQKQINSLD
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●●●● 9.12 | 9.11605283219846 | 4.6e-82 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)