Bacterial taxon 273123
Protein WP_002221800.1
30S ribosomal protein S2
Yersinia pseudotuberculosis IP 32953
Gene rpsB, UniProt Q667I9
>WP_002221800.1|Yersinia pseudotuberculosis IP 32953|30S ribosomal protein S2
MATVSMRDMLQAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELTKISSRKGKILFVGTKRAASEAVKEAANNCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLEIQSQDGTFDKLTKKEALMRTRELNKLENSLGGIKDMGGLPDALFVVDADHEHIAIKEANNLGIPVFSIVDTNSDPDGVDFIIPGNDDAIRAVKLYLGAVATAVREGRSQDLAVQAEESFVEAE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.68 | -3.68131400705057 | 1.5e-145 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.9 | -2.89557564121967 | 5.8e-24 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.64 | 1.64358726931403 | 1.0e-9 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.63 | 1.62766149325606 | 1.4e-7 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 73.8 ms
(Link to these results)