Bacterial taxon 273123
Protein WP_002218949.1
30S ribosomal protein S4
Yersinia pseudotuberculosis IP 32953
Gene rpsD, UniProt Q664U5
>WP_002218949.1|Yersinia pseudotuberculosis IP 32953|30S ribosomal protein S4
MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQPPGQHGARKPRLSDYGVQLREKQKVRRIYGVLERQFRNYYKEAARLKGNTGANLLQLLEGRLDNVVYRMGFGATRAESRQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREKAKKQSRVKAALELAEQREKPTWLEVDAVKMEGVFKRIPERTDLSADINEHLIVELYSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.54 | -3.53880153697034 | 3.0e-28 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.07 | 2.07046299384451 | 1.6e-8 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.04 | 2.03874828989948 | 9.6e-8 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.02 | -2.01946146646361 | 1.1e-8 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 4 of 1 entries in 26.6 ms
(Link to these results)