Bacterial taxon 273123
Protein WP_002210153.1
30S ribosomal protein S6
Yersinia pseudotuberculosis IP 32953
Gene rpsF, UniProt Q66FA2
>WP_002210153.1|Yersinia pseudotuberculosis IP 32953|30S ribosomal protein S6
MRHYEIVFMVHPDQSEQVPGMIERYSATITNAAGTIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDERRERHDFASEANDDSEAGDSEE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● -4.38 | -4.37645239058443 | 3.1e-81 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.69 | -2.69126806857209 | 7.2e-12 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.26 | 2.25780074965531 | 2.4e-7 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ 0.99 | 0.992790479749684 | 0.013 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Retrieved 4 of 1 entries in 17.9 ms
(Link to these results)