Bacterial taxon 273123
Protein WP_002213332.1
30S ribosomal protein S8
Yersinia pseudotuberculosis IP 32953
Gene rpsH, UniProt Q664T5
>WP_002213332.1|Yersinia pseudotuberculosis IP 32953|30S ribosomal protein S8
MSMQDPIADMLTRIRNGQAANKVAVTMPSSKLKVAIANVLKEEGFIEDFKIEGDTKPVLELALKYFQGKAVVESIQRISRPGLRIYKKKDELPKVMAGLGIAVISTSKGVMTDRAARQAGLGGEIICYVA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.25 | -3.24503789554598 | 5.0e-56 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.45 | -2.45477811851973 | 1.2e-13 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.45 | 1.44989049219369 | 1.4e-6 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ 0.99 | 0.987345108950191 | 0.0029 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Retrieved 4 of 1 entries in 33.3 ms
(Link to these results)