Bacterial taxon 273123
Protein WP_002210674.1
50S ribosomal protein L10
Yersinia pseudotuberculosis IP 32953
Gene rplJ, UniProt Q66FQ4
>WP_002210674.1|Yersinia pseudotuberculosis IP 32953|50S ribosomal protein L10
MALNLQGKQAIVAEVKEVAKGALSAVVADSRGVTVDKMTELRRAGREAGVHMQVVRNTLLRRIVEGTPFECLKDTFVGPTLIAFSAEHPGAAARLFKAFAKDNAKFEVKAAAFEGELIPAAQIDRLATLPTYEEAIARLMGTMKEAAAGKLVRTLAALRDQKEAA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.52 | -3.5187874063913 | 2.6e-125 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.36 | -2.36000790452112 | 2.1e-17 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.04 | 2.04305422669016 | 3.4e-11 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.48 | 1.48325904956095 | 1.9e-10 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Retrieved 4 of 1 entries in 31.2 ms
(Link to these results)