Bacterial taxon 273123
Protein WP_002218940.1
50S ribosomal protein L16
Yersinia pseudotuberculosis IP 32953
Gene rplP, UniProt Q664S8
>WP_002218940.1|Yersinia pseudotuberculosis IP 32953|50S ribosomal protein L16
MLQPKRTKFRKMHKGRNRGLAQGTDVSFGEFGLKACGRCRLTARQIEAARRAMTRAIKRQGKVWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLFEMAGVPEETAREAFKLAAAKLPVGTTFVTKTVM
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.26 | -3.26461352015949 | 1.5e-31 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.49 | 2.49128084824606 | 3.4e-11 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.75 | -1.74903674612022 | 7.8e-8 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.35 | 1.34991860724668 | 0.00028 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Retrieved 4 of 1 entries in 53 ms
(Link to these results)