Bacterial taxon 273123
Protein WP_002210178.1
50S ribosomal protein L21
Yersinia pseudotuberculosis IP 32953
Gene rplU, UniProt Q66F76
>WP_002210178.1|Yersinia pseudotuberculosis IP 32953|50S ribosomal protein L21
MYAVFQSGGKQHRVSEGQTIRLEKLDIATGETIEFDQVLMIANGEEINIGAPLVDGGKIKAEIIAHGRGEKIKIVKFRRRKHYRKQQGHRQWFTDVKITGISA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● -4.75 | -4.75088146983739 | 7.1e-106 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.35 | -3.34885304565623 | 2.7e-32 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.41 | -1.41291396674942 | 0.00016 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ 0.98 | 0.976244344022287 | 0.0064 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 16.1 ms
(Link to these results)